Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus gii [TaxId:122929] [419975] (3 PDB entries) |
Domain d5lkka1: 5lkk A:225-530 [415031] Other proteins in same PDB: d5lkka2, d5lkkb2 automated match to d5or7a_ complexed with edo, mg |
PDB Entry: 5lkk (more details), 1.49 Å
SCOPe Domain Sequences for d5lkka1:
Sequence, based on SEQRES records: (download)
>d5lkka1 b.121.4.0 (A:225-530) automated matches {Norovirus gii [TaxId: 122929]} kpfslpiltlseltnsrfpvpidslftaqnnvlqvqcqngrctldgelqgttqllptgic afrgrvtaqinqrdrwhmqlqnlngttydptddvpaplgtpdfkgvvfgmvsqrnvgnda pgstraqqawvstyspqfvpklgsvnlrisdnddfqfqptkftpvgvnddddghpfrqwe lpnysgeltlnmnlappvapnfpgeqllffrsfvpcsggynqgiidclipqewiqhfyqe sapsqsdvaliryvnpdtgrtlfeaklhrsgyitvahsgdyplvvpanghfrfdswvnqf yslapm
>d5lkka1 b.121.4.0 (A:225-530) automated matches {Norovirus gii [TaxId: 122929]} kpfslpiltlseltnsrfpvpidslftaqnnqvqcqngrctldgelqgttqllptgicaf rgrvtaqinqrdrwhmqlqnlngttydptddvpaplgtpdfkgvvfgmvsqrnvgndapg straqqawvstyspqfvpklgsvnlrisdnddfqfqptkftpvgvnddddghpfrqwelp nysgeltlnmnlappvapnfpgeqllffrsfvpcsggynqgiidclipqewiqhfyqesa psqsdvaliryvnpdtgrtlfeaklhrsgyitvahsgdyplvvpanghfrfdswvnqfys lapm
Timeline for d5lkka1: