Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus gii.4 [TaxId:489821] [419970] (1 PDB entry) |
Domain d5kona1: 5kon A:225-530 [415004] Other proteins in same PDB: d5kona2, d5konb2 automated match to d5or7a_ complexed with edo, mes |
PDB Entry: 5kon (more details), 1.51 Å
SCOPe Domain Sequences for d5kona1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kona1 b.121.4.0 (A:225-530) automated matches {Norovirus gii.4 [TaxId: 489821]} kpfsvpvltveemtnsrfpipleklftgpssafvvqpqngrcttdgvllgttqlspvnic tfrgdvthitgsrnytmnlasqnwnnydpteeipaplgapdfvgkiqgmltqttradgst rghkatvytgsadfapklgrvqfetdtdhdfeanqntkftpvgviqdgstthrnepqqwv lpsysgrnthnvhlapavaptfpgeqllffrstmpgcsgypnmdldcllpqewvqyfyqe aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf ytlapm
Timeline for d5kona1: