Lineage for d1ez1a3 (1ez1 A:113-318)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541397Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2541546Protein Glycinamide ribonucleotide transformylase PurT, domain 2 [56074] (1 species)
  7. 2541547Species Escherichia coli [TaxId:562] [56075] (7 PDB entries)
  8. 2541558Domain d1ez1a3: 1ez1 A:113-318 [41500]
    Other proteins in same PDB: d1ez1a1, d1ez1a2, d1ez1b1, d1ez1b2
    complexed with act, anp, gar, mg, mpo, na

Details for d1ez1a3

PDB Entry: 1ez1 (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1ez1a3:

Sequence, based on SEQRES records: (download)

>d1ez1a3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records): (download)

>d1ez1a3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyresw
qpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlis
qdlsefalhvraflglpvggirqy

SCOPe Domain Coordinates for d1ez1a3:

Click to download the PDB-style file with coordinates for d1ez1a3.
(The format of our PDB-style files is described here.)

Timeline for d1ez1a3: