Lineage for d1eyza3 (1eyz A:113-318)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84221Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 84222Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 84242Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 84312Protein Glycinamide ribonucleotide transformylase PurT [56074] (1 species)
  7. 84313Species Escherichia coli [TaxId:562] [56075] (2 PDB entries)
  8. 84314Domain d1eyza3: 1eyz A:113-318 [41498]
    Other proteins in same PDB: d1eyza1, d1eyza2, d1eyzb1, d1eyzb2

Details for d1eyza3

PDB Entry: 1eyz (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp

SCOP Domain Sequences for d1eyza3:

Sequence, based on SEQRES records: (download)

>d1eyza3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyre
swqpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtl
isqdlsefalhvraflglpvggirqy

Sequence, based on observed residues (ATOM records): (download)

>d1eyza3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
nregirrlaaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsae
qlaqawkyaqqggragrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyresw
qpqqmsplaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlis
qdlsefalhvraflglpvggirqy

SCOP Domain Coordinates for d1eyza3:

Click to download the PDB-style file with coordinates for d1eyza3.
(The format of our PDB-style files is described here.)

Timeline for d1eyza3: