SCOPe 2.08: Domain d5j5ib1: 5j5i B:1-205

Lineage for d5j5ib1 (5j5i B:1-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d5j5ib1: 5j5i B:1-205 [414969]
   Other proteins in same PDB: d5j5ia2, d5j5ib2, d5j5ic2, d5j5id2, d5j5ie2, d5j5if2, d5j5ig2, d5j5ih2, d5j5ii2, d5j5ij2
   automated match to d7ndvg_
   complexed with 6gm, nag, po4

Details for d5j5ib1

PDB Entry: 5j5i, 2.33 Å

PDB Description: x-ray crystal structure of acetylcholine binding protein (achbp) in complex with 4-(2-amino-6-{bis[(pyridin-2-yl)methyl]amino}pyrimidin- 4-yl)phenol

PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d5j5ib1:

Sequence; same for both SEQRES and ATOM records:

>d5j5ib1 b.96.1.1 (B:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Timeline for d5j5ib1:

• d5j5ib1 is new in SCOPe 2.08-stable