Lineage for d1b6sc3 (1b6s C:79-276)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978719Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 [56072] (1 species)
  7. 2978720Species Escherichia coli [TaxId:562] [56073] (4 PDB entries)
  8. 2978728Domain d1b6sc3: 1b6s C:79-276 [41496]
    Other proteins in same PDB: d1b6sa1, d1b6sa2, d1b6sb1, d1b6sb2, d1b6sc1, d1b6sc2, d1b6sd1, d1b6sd2
    complexed with adp, mg

Details for d1b6sc3

PDB Entry: 1b6s (more details), 2.5 Å

PDB Description: structure of n5-carboxyaminoimidazole ribonucleotide synthetase
PDB Compounds: (C:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOPe Domain Sequences for d1b6sc3:

Sequence, based on SEQRES records: (download)

>d1b6sc3 d.142.1.2 (C:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]}
drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtggydgrgqwrlrane
teqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqa
naqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisq
felhlraitdlplpqpvv

Sequence, based on observed residues (ATOM records): (download)

>d1b6sc3 d.142.1.2 (C:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]}
drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtggqwrlraneteqlp
aecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqanaqqq
araeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisqfelhl
raitdlplpqpvv

SCOPe Domain Coordinates for d1b6sc3:

Click to download the PDB-style file with coordinates for d1b6sc3.
(The format of our PDB-style files is described here.)

Timeline for d1b6sc3: