Lineage for d1b6ra3 (1b6r A:79-276)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36117Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 36193Protein N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK [56072] (1 species)
  7. 36194Species Escherichia coli [TaxId:562] [56073] (2 PDB entries)
  8. 36195Domain d1b6ra3: 1b6r A:79-276 [41493]
    Other proteins in same PDB: d1b6ra1, d1b6ra2

Details for d1b6ra3

PDB Entry: 1b6r (more details), 2.1 Å

PDB Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli

SCOP Domain Sequences for d1b6ra3:

Sequence, based on SEQRES records: (download)

>d1b6ra3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK {Escherichia coli}
drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtggydgrgqwrlrane
teqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqa
naqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisq
felhlraitdlplpqpvv

Sequence, based on observed residues (ATOM records): (download)

>d1b6ra3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK {Escherichia coli}
drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtgqwrlraneteqlpa
ecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqanaqqqa
raeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisqfelhlr
aitdlplpqpvv

SCOP Domain Coordinates for d1b6ra3:

Click to download the PDB-style file with coordinates for d1b6ra3.
(The format of our PDB-style files is described here.)

Timeline for d1b6ra3: