Lineage for d1gsoa3 (1gso A:104-327)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137856Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 137857Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 137877Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 137952Protein Glycinamide ribonucleotide synthetase (GAR-syn) [56070] (1 species)
  7. 137953Species Escherichia coli [TaxId:562] [56071] (1 PDB entry)
  8. 137954Domain d1gsoa3: 1gso A:104-327 [41492]
    Other proteins in same PDB: d1gsoa1, d1gsoa2

Details for d1gsoa3

PDB Entry: 1gso (more details), 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.

SCOP Domain Sequences for d1gsoa3:

Sequence, based on SEQRES records: (download)

>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn) {Escherichia coli}
skaftkdflarhkiptaeyqnftevepalaylrekgapivikadglaagkgvivamtlee
aeaavhdmlagnafgdaghrivieefldgeeasfivmvdgehvlpmatsqdhkrvgdkdt
gpntggmgayspapvvtddvhqrtmeriiwptvkgmaaegntytgflyaglmidkqgnpk
viefncrfgdletqpimlrmksdlvelclaaceskldektsewd

Sequence, based on observed residues (ATOM records): (download)

>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn) {Escherichia coli}
skaftkdflarhkiptaeyqnftevepalaylrekgapivikakgvivamtleeaeaavh
dmlagnafgdaghrivieefldgeeasfivmvdgehvlpmatsqdhkrvgdkdtgpntgg
mgayspapvvtddvhqrtmeriiwptvkgmaaegntytgflyaglmidkqgnpkviefnc
rfgdletqpimlrmksdlvelclaaceskldektsewd

SCOP Domain Coordinates for d1gsoa3:

Click to download the PDB-style file with coordinates for d1gsoa3.
(The format of our PDB-style files is described here.)

Timeline for d1gsoa3: