Lineage for d1dv2b3 (1dv2 B:115-330)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734348Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) (S)
  5. 734368Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 734375Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 734378Species Escherichia coli [TaxId:562] [56069] (5 PDB entries)
  8. 734388Domain d1dv2b3: 1dv2 B:115-330 [41491]
    Other proteins in same PDB: d1dv2a1, d1dv2a2, d1dv2b1, d1dv2b2
    complexed with atp; mutant

Details for d1dv2b3

PDB Entry: 1dv2 (more details), 2.5 Å

PDB Description: the structure of biotin carboxylase, mutant e288k, complexed with atp
PDB Compounds: (B:) biotin carboxylase

SCOP Domain Sequences for d1dv2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv2b3 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfikmntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOP Domain Coordinates for d1dv2b3:

Click to download the PDB-style file with coordinates for d1dv2b3.
(The format of our PDB-style files is described here.)

Timeline for d1dv2b3: