![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) ![]() |
![]() | Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins) |
![]() | Protein Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), domain 2 [56068] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56069] (3 PDB entries) |
![]() | Domain d1dv2b3: 1dv2 B:115-330 [41491] Other proteins in same PDB: d1dv2a1, d1dv2a2, d1dv2b1, d1dv2b2 complexed with atp; mutant |
PDB Entry: 1dv2 (more details), 2.5 Å
SCOP Domain Sequences for d1dv2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv2b3 d.142.1.2 (B:115-330) Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), domain 2 {Escherichia coli} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfikmntriq vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d1dv2b3: