Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins) lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain |
Protein automated matches [254715] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [419966] (5 PDB entries) |
Domain d5is8b_: 5is8 B: [414906] automated match to d2v7ea_ protein/RNA complex; complexed with 6d1, edo, sah |
PDB Entry: 5is8 (more details), 2.71 Å
SCOPe Domain Sequences for d5is8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5is8b_ c.66.1.6 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqa garkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfn ermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsa lrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvh glafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankr qsydisivaqvdqtgskssnlldlknpffryt
Timeline for d5is8b_: