SCOPe 2.08: Domain d5is8b_: 5is8 B:

Lineage for d5is8b_ (5is8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
   lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain

6. Protein automated matches [254715] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [419966] (5 PDB entries)

8. Domain d5is8b_: 5is8 B: [414906]
   automated match to d2v7ea_
   protein/RNA complex; complexed with 6d1, edo, sah

Details for d5is8b_

PDB Entry: 5is8, 2.71 Å

PDB Description: crystal structure of mouse carm1 in complex with inhibitor sa0271

PDB Compounds: (B:) histone-arginine methyltransferase carm1

SCOPe Domain Sequences for d5is8b_:

Sequence; same for both SEQRES and ATOM records:

>d5is8b_ c.66.1.6 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqa
garkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfn
ermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsa
lrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvh
glafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankr
qsydisivaqvdqtgskssnlldlknpffryt

Timeline for d5is8b_:

• d5is8b_ is new in SCOPe 2.08-stable