Lineage for d1bncb3 (1bnc B:115-330)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041792Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1041793Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1041813Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 1041820Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1041823Species Escherichia coli [TaxId:562] [56069] (7 PDB entries)
  8. 1041833Domain d1bncb3: 1bnc B:115-330 [41489]
    Other proteins in same PDB: d1bnca1, d1bnca2, d1bncb1, d1bncb2
    complexed with po4

Details for d1bncb3

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d1bncb3:

Sequence, based on SEQRES records: (download)

>d1bncb3 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d1bncb3 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgddmdknraiakrigypviikrvvrgdaelaqsismtra
ymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelrryige
rcakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeqlriaag
qplsikqeevhv

SCOPe Domain Coordinates for d1bncb3:

Click to download the PDB-style file with coordinates for d1bncb3.
(The format of our PDB-style files is described here.)

Timeline for d1bncb3: