Lineage for d1bnca3 (1bnc A:115-330)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36117Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 36118Protein Biotin carboxylase subunit of acetyl-CoA carboxylase [56068] (1 species)
  7. 36119Species Escherichia coli [TaxId:562] [56069] (3 PDB entries)
  8. 36122Domain d1bnca3: 1bnc A:115-330 [41488]
    Other proteins in same PDB: d1bnca1, d1bnca2, d1bncb1, d1bncb2

Details for d1bnca3

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bnca3:

Sequence, based on SEQRES records: (download)

>d1bnca3 d.142.1.2 (A:115-330) Biotin carboxylase subunit of acetyl-CoA carboxylase {Escherichia coli}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d1bnca3 d.142.1.2 (A:115-330) Biotin carboxylase subunit of acetyl-CoA carboxylase {Escherichia coli}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikrgmrvvrgdaelaqs
ismtraeakmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapg
itpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvd
likeqlriaagqplsikqeevhv

SCOP Domain Coordinates for d1bnca3:

Click to download the PDB-style file with coordinates for d1bnca3.
(The format of our PDB-style files is described here.)

Timeline for d1bnca3: