Lineage for d1ehib2 (1ehi B:535-770)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins)
  6. Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species)
  7. Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [56066] (1 PDB entry)
  8. Domain d1ehib2: 1ehi B:535-770 [41485]
    Other proteins in same PDB: d1ehia1, d1ehib1
    complexed with adp, mg, phy

Details for d1ehib2

PDB Entry: 1ehi (more details), 2.38 Å

PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
PDB Compounds: (B:) d-alanine:d-lactate ligase

SCOPe Domain Sequences for d1ehib2:

Sequence, based on SEQRES records: (download)

>d1ehib2 d.142.1.1 (B:535-770) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
dkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaanqgssvgisrvt
naeeytealsdsfqydykvlieeavngarelevgvigndqplvseigahtvpnqgsgdgw
ydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgearmdflldennvpyl
gepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkklsysfvslge

Sequence, based on observed residues (ATOM records): (download)

>d1ehib2 d.142.1.1 (B:535-770) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
dkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaanqgssvgisrvt
naeeytealsdsfqydykvlieeavngarelevgvigndqplvseigahtvhfqipaqls
pevtkevkqmaldaykvlnlrgearmdflldennvpylgepntlpgftnmslfkrlwdys
dinnaklvdmlidygfedfaqnkklsysfvslge

SCOPe Domain Coordinates for d1ehib2 are not available.

Timeline for d1ehib2:

Domains from same chain:
(mouse over for more information)
d1ehib1
Domains from other chains:
(mouse over for more information)
d1ehia1, d1ehia2