Lineage for d2dlna2 (2dln A:97-306)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671106Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (3 proteins)
  6. 1671107Protein D-ala-D-ala ligase, C-domain [56063] (1 species)
  7. 1671108Species Escherichia coli, gene ddlB [TaxId:562] [56064] (3 PDB entries)
  8. 1671111Domain d2dlna2: 2dln A:97-306 [41483]
    Other proteins in same PDB: d2dlna1
    complexed with adp, mg, phy

Details for d2dlna2

PDB Entry: 2dln (more details), 2.3 Å

PDB Description: vancomycin resistance: structure of d-alanine:d-alanine ligase at 2.3 angstroms resolution
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2dlna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlna2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]}
klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk
vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky
lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg
mtshslvpmaarqagmsfsqlvvrilelad

SCOPe Domain Coordinates for d2dlna2:

Click to download the PDB-style file with coordinates for d2dlna2.
(The format of our PDB-style files is described here.)

Timeline for d2dlna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlna1