Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (3 proteins) |
Protein D-ala-D-ala ligase, C-domain [56063] (1 species) |
Species Escherichia coli, gene ddlB [TaxId:562] [56064] (3 PDB entries) |
Domain d2dlna2: 2dln A:97-306 [41483] Other proteins in same PDB: d2dlna1 complexed with adp, mg, phy |
PDB Entry: 2dln (more details), 2.3 Å
SCOPe Domain Sequences for d2dlna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlna2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg mtshslvpmaarqagmsfsqlvvrilelad
Timeline for d2dlna2: