Lineage for d2dln_2 (2dln 97-306)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36101Family d.142.1.1: Peptide synthetases, C-terminal domain [56060] (3 proteins)
  6. 36102Protein D-ala-D-ala ligase [56063] (1 species)
  7. 36103Species Escherichia coli, gene ddlB [TaxId:562] [56064] (3 PDB entries)
  8. 36106Domain d2dln_2: 2dln 97-306 [41483]
    Other proteins in same PDB: d2dln_1

Details for d2dln_2

PDB Entry: 2dln (more details), 2.3 Å

PDB Description: vancomycin resistance: structure of d-alanine:d-alanine ligase at 2.3 angstroms resolution

SCOP Domain Sequences for d2dln_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dln_2 d.142.1.1 (97-306) D-ala-D-ala ligase {Escherichia coli, gene ddlB}
klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk
vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky
lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg
mtshslvpmaarqagmsfsqlvvrilelad

SCOP Domain Coordinates for d2dln_2:

Click to download the PDB-style file with coordinates for d2dln_2.
(The format of our PDB-style files is described here.)

Timeline for d2dln_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dln_1