Class g: Small proteins [56992] (100 folds) |
Fold g.102: Jumonji C-terminal domain-like [418708] (1 superfamily) alpha + beta fold, with C5HC2 zinc finger binding 2 zinc ions |
Superfamily g.102.1: Jumonji C-terminal domain-like [418737] (2 families) |
Family g.102.1.0: automated matches [418884] (1 protein) not a true family |
Protein automated matches [419260] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [419944] (40 PDB entries) |
Domain d5fz9a2: 5fz9 A:623-753 [414793] Other proteins in same PDB: d5fz9a1, d5fz9a3 automated match to d5a1fa2 complexed with cl, dms, edo, epe, mn, nuk, po4, zn |
PDB Entry: 5fz9 (more details), 2.06 Å
SCOPe Domain Sequences for d5fz9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fz9a2 g.102.1.0 (A:623-753) automated matches {Human (Homo sapiens) [TaxId: 9606]} rycvfshdemickmaskadvldvvvastvqkdmaimiedekalretvrklgvidsermdf ellpdderqcvkckttcfmsaiscsckpgllvclhhvkelcscppykyklryrytlddly pmmnalklrae
Timeline for d5fz9a2: