SCOPe 2.08: Domain d5fz4a1: 5fz4 A:26-622

Lineage for d5fz4a1 (5fz4 A:26-622)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
   Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)

6. Protein automated matches [254635] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255633] (100 PDB entries)

8. Domain d5fz4a1: 5fz4 A:26-622 [414780]
   Other proteins in same PDB: d5fz4a2, d5fz4a3
   automated match to d5a1fa1
   complexed with cl, dms, edo, mn, p6b, po4, zn

Details for d5fz4a1

PDB Entry: 5fz4, 2.07 Å

PDB Description: crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment (3r)-1-[(3-phenyl-1,2,4-oxadiazol-5-yl) methyl]pyrrolidin-3-ol (n10057a) (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)

PDB Compounds: (A:) Lysine-specific demethylase 5B

SCOPe Domain Sequences for d5fz4a1:

Sequence, based on SEQRES records:

>d5fz4a1 b.82.2.14 (A:26-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flpppecpvfepsweefadpfafihkirpiaeqtgickvrpppdwqppfacdvdklhftp
riqrlneleaqtrvklggggardytlrtfgemadafksdyfnmpvhmvptelvekefwrl
vstieedvtveygadiaskefgsgfpvrdgkiklspeeeeyldsgwnlnnmpvmeqsvla
hitadicgmklpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpgyaaeqlenv
mkklapelfvsqpdllhqlvtimnpntlmthevpvyrtnqcagefvitfprayhsgfnqg
fnfaeavnfctvdwlplgrqcvehyrllh

Sequence, based on observed residues (ATOM records):

>d5fz4a1 b.82.2.14 (A:26-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flpppecpvfepsweefadpfafihkirpiaeqtgickvrpppdwqppfacdvdklhftp
riqrlneleaqtrvkdytlrtfgemadafksdyfnmpvhmvptelvekefwrlvstieed
vtveygadiaskefgsgfpvrdiklspeeeeyldsgwnlnnmpvmeqsvlahitaicgmk
lpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpgyaaeqlenvmkklapelfv
sqpdllhqlvtimnpntlmthevpvyrtnqcagefvitfprayhsgfnqgfnfaeavnfc
tvdwlplgrqcvehyrllh

Timeline for d5fz4a1:

• d5fz4a1 is new in SCOPe 2.08-stable