SCOP 1.55: Domain d1gsa_2: 1gsa 123-314

Lineage for d1gsa_2 (1gsa 123-314)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families)

5. Family d.142.1.1: Peptide synthetases, C-terminal domain [56060] (3 proteins)

6. Protein Glutathione synthetase [56061] (1 species)

7. Species Escherichia coli [TaxId:562] [56062] (4 PDB entries)

8. Domain d1gsa_2: 1gsa 123-314 [41477]
   Other proteins in same PDB: d1gsa_1

Details for d1gsa_2

PDB Entry: 1gsa, 2 Å

PDB Description: structure of glutathione synthetase complexed with adp and glutathione

SCOP Domain Sequences for d1gsa_2:

Sequence; same for both SEQRES and ATOM records:

>d1gsa_2 d.142.1.1 (123-314) Glutathione synthetase {Escherichia coli}
neklftawfsdltpetlvtrnkaqlkafwekhsdiilkpldgmggasifrvkegdpnlgv
iaetltehgtrycmaqnylpaikdgdkrvlvvdgepvpyclaripqggetrgnlaaggrg
eprpltesdwkiarqigptlkekglifvgldiigdrlteinvtsptcireieaefpvsit
gmlmdaiearlq

Timeline for d1gsa_2:

• d1gsa_2 appears in SCOP 1.57
  
• d1gsa_2 appears in the current release, SCOPe 2.08, called d1gsaa2