SCOPe 2.08: Domain d1gsaa2: 1gsa A:123-314

Lineage for d1gsaa2 (1gsa A:123-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins)

6. Protein Prokaryotic glutathione synthetase, C-domain [56061] (1 species)

7. Species Escherichia coli [TaxId:562] [56062] (4 PDB entries)

8. Domain d1gsaa2: 1gsa A:123-314 [41477]
   Other proteins in same PDB: d1gsaa1
   complexed with adp, gsh, mg, so4

Details for d1gsaa2

PDB Entry: 1gsa, 2 Å

PDB Description: structure of glutathione synthetase complexed with adp and glutathione

PDB Compounds: (A:) glutathione synthetase

SCOPe Domain Sequences for d1gsaa2:

Sequence; same for both SEQRES and ATOM records:

>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]}
neklftawfsdltpetlvtrnkaqlkafwekhsdiilkpldgmggasifrvkegdpnlgv
iaetltehgtrycmaqnylpaikdgdkrvlvvdgepvpyclaripqggetrgnlaaggrg
eprpltesdwkiarqigptlkekglifvgldiigdrlteinvtsptcireieaefpvsit
gmlmdaiearlq

Timeline for d1gsaa2:

• d1gsaa2 first appeared (with stable ids) in SCOP 1.55, called d1gsa_2
  
• d1gsaa2 appears in SCOPe 2.07