Lineage for d1ffk12 (1ffk 1:80-172)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219397Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1219398Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1219399Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1219400Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1219472Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1219552Domain d1ffk12: 1ffk 1:80-172 [41476]
    Other proteins in same PDB: d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    CA-atoms only
    complexed with cd, k, mg

Details for d1ffk12

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (1:) ribosomal protein l6

SCOPe Domain Sequences for d1ffk12:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffk12 d.141.1.1 (1:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOPe Domain Coordinates for d1ffk12:

Click to download the PDB-style file with coordinates for d1ffk12.
(The format of our PDB-style files is described here.)

Timeline for d1ffk12: