Lineage for d5fy4a2 (5fy4 A:623-753)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039154Fold g.102: Jumonji C-terminal domain-like [418708] (1 superfamily)
    alpha + beta fold, with C5HC2 zinc finger binding 2 zinc ions
  4. 3039155Superfamily g.102.1: Jumonji C-terminal domain-like [418737] (2 families) (S)
  5. 3039173Family g.102.1.0: automated matches [418884] (1 protein)
    not a true family
  6. 3039174Protein automated matches [419260] (1 species)
    not a true protein
  7. 3039175Species Human (Homo sapiens) [TaxId:9606] [419944] (40 PDB entries)
  8. 3039201Domain d5fy4a2: 5fy4 A:623-753 [414742]
    Other proteins in same PDB: d5fy4a1, d5fy4a3
    automated match to d5a1fa2
    complexed with edo, fum, mn, zn

Details for d5fy4a2

PDB Entry: 5fy4 (more details), 2.1 Å

PDB Description: crystal structure of the catalytic domain of human jarid1b in complex with succinate
PDB Compounds: (A:) Lysine-specific demethylase 5B

SCOPe Domain Sequences for d5fy4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fy4a2 g.102.1.0 (A:623-753) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rycvfshdemickmaskadvldvvvastvqkdmaimiedekalretvrklgvidsermdf
ellpdderqcvkckttcfmsaiscsckpgllvclhhvkelcscppykyklryrytlddly
pmmnalklrae

SCOPe Domain Coordinates for d5fy4a2:

Click to download the PDB-style file with coordinates for d5fy4a2.
(The format of our PDB-style files is described here.)

Timeline for d5fy4a2:

  • d5fy4a2 is new in SCOPe 2.08-stable