SCOPe 2.05: Domain d1rl6a2: 1rl6 A:82-170

Lineage for d1rl6a2 (1rl6 A:82-170)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Bacillus stearothermophilus [TaxId:1422] [56056] (1 PDB entry)

8. Domain d1rl6a2: 1rl6 A:82-170 [41474]

Details for d1rl6a2

PDB Entry: 1rl6, 2 Å

PDB Description: ribosomal protein l6

PDB Compounds: (A:) protein (ribosomal protein l6)

SCOPe Domain Sequences for d1rl6a2:

Sequence; same for both SEQRES and ATOM records:

>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

Timeline for d1rl6a2:

• d1rl6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1rl6a2 appears in SCOPe 2.04
  
• d1rl6a2 appears in SCOPe 2.06
  
• d1rl6a2 appears in the current release, SCOPe 2.08