![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [56056] (1 PDB entry) |
![]() | Domain d1rl6a2: 1rl6 A:82-170 [41474] |
PDB Entry: 1rl6 (more details), 2 Å
SCOP Domain Sequences for d1rl6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus} yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg elaaniravrppepykgkgiryegelvrl
Timeline for d1rl6a2: