Lineage for d5fwja2 (5fwj A:638-769)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039154Fold g.102: Jumonji C-terminal domain-like [418708] (1 superfamily)
    alpha + beta fold, with C5HC2 zinc finger binding 2 zinc ions
  4. 3039155Superfamily g.102.1: Jumonji C-terminal domain-like [418737] (2 families) (S)
  5. 3039173Family g.102.1.0: automated matches [418884] (1 protein)
    not a true family
  6. 3039174Protein automated matches [419260] (1 species)
    not a true protein
  7. 3039175Species Human (Homo sapiens) [TaxId:9606] [419944] (40 PDB entries)
  8. 3039196Domain d5fwja2: 5fwj A:638-769 [414736]
    Other proteins in same PDB: d5fwja1, d5fwja3, d5fwjb1, d5fwjb3
    automated match to d5a1fa2
    complexed with mg, mmk, mn, zn

Details for d5fwja2

PDB Entry: 5fwj (more details), 2.1 Å

PDB Description: crystal structure of human jarid1c in complex with kdm5-c49
PDB Compounds: (A:) Histone demethylase JARID1C

SCOPe Domain Sequences for d5fwja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwja2 g.102.1.0 (A:638-769) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rycvfsheelickmaacpekldlnlaaavhkemfimvqeerrlrkallekgiteaereaf
ellpdderqcikckttcflsalacydcpdglvclshindlckcsssrqylryrytldelp
amlhklkvraes

SCOPe Domain Coordinates for d5fwja2:

Click to download the PDB-style file with coordinates for d5fwja2.
(The format of our PDB-style files is described here.)

Timeline for d5fwja2:

  • d5fwja2 is new in SCOPe 2.08-stable