Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56056] (1 PDB entry) |
Domain d1rl6a1: 1rl6 A:7-81 [41473] |
PDB Entry: 1rl6 (more details), 2 Å
SCOP Domain Sequences for d1rl6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus} pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt trsllanmvegvskg
Timeline for d1rl6a1: