Lineage for d1rl6a1 (1rl6 A:7-81)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) 
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) Protein Ribosomal protein L6 [56055] (2 species) Species Bacillus stearothermophilus [TaxId:1422] [56056] (1 PDB entry) 
Domain d1rl6a1: 1rl6 A:7-81 [41473]
Details for d1rl6a1
PDB Entry: 1rl6 (more details), 2 Å
PDB Description: ribosomal protein l6
SCOP Domain Sequences for d1rl6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskg
SCOP Domain Coordinates for d1rl6a1:
Click to download the PDB-style file with coordinates for d1rl6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rl6a1:
- d1rl6a1 first appeared (with stable ids) in SCOP 1.55
- d1rl6a1 appears in SCOP 1.59
- d1rl6a1 appears in SCOP 1.63
- d1rl6a1 appears in the current release, SCOPe 2.08
View in 3D
