Lineage for d1hnwh_ (1hnw H:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196944Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 196945Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 196946Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 196947Protein Ribosomal protein S8 [56049] (3 species)
  7. 196954Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)
  8. 196961Domain d1hnwh_: 1hnw H: [41471]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwh_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (H:)

SCOP Domain Sequences for d1hnwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1hnwh_:

Click to download the PDB-style file with coordinates for d1hnwh_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwh_: