Lineage for d1hr0h_ (1hr0 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217010Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2217011Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2217012Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2217013Protein Ribosomal protein S8 [56049] (4 species)
  7. 2217031Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2217046Domain d1hr0h_: 1hr0 H: [41469]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0h_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1hr0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1hr0h_:

Click to download the PDB-style file with coordinates for d1hr0h_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0h_: