SCOPe 2.08: Domain d1hr0h_: 1hr0 H:

Lineage for d1hr0h_ (1hr0 H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)
   automatically mapped to Pfam PF00410

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
   Uniprot P24319

8. Domain d1hr0h_: 1hr0 H: [41469]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
   complexed with mg, zn

Details for d1hr0h_

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1hr0h_:

Sequence; same for both SEQRES and ATOM records:

>d1hr0h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d1hr0h_:

• d1hr0h_ first appeared (with stable ids) in SCOP 1.55
  
• d1hr0h_ appears in SCOPe 2.07