SCOP 1.75: Domain d1seib_: 1sei B:

Lineage for d1seib_ (1sei B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56050] (1 PDB entry)

8. Domain d1seib_: 1sei B: [41464]

Details for d1seib_

PDB Entry: 1sei, 1.9 Å

PDB Description: structure of 30s ribosomal protein s8

PDB Compounds: (B:) ribosomal protein s8

SCOP Domain Sequences for d1seib_:

Sequence; same for both SEQRES and ATOM records:

>d1seib_ d.140.1.1 (B:) Ribosomal protein S8 {Bacillus stearothermophilus [TaxId: 1422]}
vmtdpiadmltairnanmvrheklevpaskikreiaeilkregfirdyeyiednkqgilr
iflkygpnervitglkriskpglrvyvkahevprvlnglgiailstsqgvltdkearqkg
tggeiiayvi

Timeline for d1seib_:

• d1seib_ first appeared (with stable ids) in SCOP 1.55
  
• d1seib_ appears in SCOP 1.73
  
• d1seib_ appears in SCOPe 2.01
  
• d1seib_ appears in the current release, SCOPe 2.08