Lineage for d1seib_ (1sei B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137819Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 137820Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 137821Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 137822Protein Ribosomal protein S8 [56049] (3 species)
  7. 137826Species Bacillus stearothermophilus [TaxId:1422] [56050] (1 PDB entry)
  8. 137828Domain d1seib_: 1sei B: [41464]

Details for d1seib_

PDB Entry: 1sei (more details), 1.9 Å

PDB Description: structure of 30s ribosomal protein s8

SCOP Domain Sequences for d1seib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seib_ d.140.1.1 (B:) Ribosomal protein S8 {Bacillus stearothermophilus}
vmtdpiadmltairnanmvrheklevpaskikreiaeilkregfirdyeyiednkqgilr
iflkygpnervitglkriskpglrvyvkahevprvlnglgiailstsqgvltdkearqkg
tggeiiayvi

SCOP Domain Coordinates for d1seib_:

Click to download the PDB-style file with coordinates for d1seib_.
(The format of our PDB-style files is described here.)

Timeline for d1seib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1seia_