Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [56050] (1 PDB entry) |
Domain d1seib_: 1sei B: [41464] |
PDB Entry: 1sei (more details), 1.9 Å
SCOP Domain Sequences for d1seib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seib_ d.140.1.1 (B:) Ribosomal protein S8 {Bacillus stearothermophilus} vmtdpiadmltairnanmvrheklevpaskikreiaeilkregfirdyeyiednkqgilr iflkygpnervitglkriskpglrvyvkahevprvlnglgiailstsqgvltdkearqkg tggeiiayvi
Timeline for d1seib_: