SCOPe 2.06: Domain d1seia_: 1sei A:

Lineage for d1seia_ (1sei A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)
   automatically mapped to Pfam PF00410

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56050] (1 PDB entry)

8. Domain d1seia_: 1sei A: [41463]

Details for d1seia_

PDB Entry: 1sei, 1.9 Å

PDB Description: structure of 30s ribosomal protein s8

PDB Compounds: (A:) ribosomal protein s8

SCOPe Domain Sequences for d1seia_:

Sequence; same for both SEQRES and ATOM records:

>d1seia_ d.140.1.1 (A:) Ribosomal protein S8 {Bacillus stearothermophilus [TaxId: 1422]}
vmtdpiadmltairnanmvrheklevpaskikreiaeilkregfirdyeyiednkqgilr
iflkygpnervitglkriskpglrvyvkahevprvlnglgiailstsqgvltdkearqkg
tggeiiayvi

Timeline for d1seia_:

• d1seia_ first appeared (with stable ids) in SCOP 1.55
  
• d1seia_ appears in SCOPe 2.05
  
• d1seia_ appears in SCOPe 2.07
  
• d1seia_ appears in the current release, SCOPe 2.08