SCOP 1.73: Domain d1clic2: 1cli C:2171-2345

Lineage for d1clic2 (1cli C:2171-2345)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (4 proteins)

6. Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (1 species)

7. Species Escherichia coli [TaxId:562] [56045] (1 PDB entry)

8. Domain d1clic2: 1cli C:2171-2345 [41461]
   Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1

Details for d1clic2

PDB Entry: 1cli, 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution

PDB Compounds: (C:) protein (phosphoribosyl-aminoimidazole synthetase)

SCOP Domain Sequences for d1clic2:

Sequence; same for both SEQRES and ATOM records:

>d1clic2 d.139.1.1 (C:2171-2345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]}
dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv
ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve
hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie

Timeline for d1clic2:

• d1clic2 first appeared (with stable ids) in SCOP 1.55
  
• d1clic2 appears in SCOP 1.71
  
• d1clic2 appears in SCOP 1.75
  
• d1clic2 appears in the current release, SCOPe 2.08