![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
![]() | Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [56045] (1 PDB entry) |
![]() | Domain d1clic2: 1cli C:2171-2345 [41461] Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1 complexed with so4 |
PDB Entry: 1cli (more details), 2.5 Å
SCOPe Domain Sequences for d1clic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clic2 d.139.1.1 (C:2171-2345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]} dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie
Timeline for d1clic2: