Lineage for d1clib2 (1cli B:1171-1345)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418823Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 418824Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 418825Family d.139.1.1: PurM C-terminal domain-like [56043] (2 proteins)
  6. 418826Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (1 species)
  7. 418827Species Escherichia coli [TaxId:562] [56045] (1 PDB entry)
  8. 418829Domain d1clib2: 1cli B:1171-1345 [41460]
    Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1

Details for d1clib2

PDB Entry: 1cli (more details), 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution

SCOP Domain Sequences for d1clib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clib2 d.139.1.1 (B:1171-1345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli}
dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv
ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve
hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie

SCOP Domain Coordinates for d1clib2:

Click to download the PDB-style file with coordinates for d1clib2.
(The format of our PDB-style files is described here.)

Timeline for d1clib2: