SCOPe 2.08: Domain d1clib2: 1cli B:1171-1345

Lineage for d1clib2 (1cli B:1171-1345)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (2 species)

7. Species Escherichia coli [TaxId:562] [56045] (1 PDB entry)

8. Domain d1clib2: 1cli B:1171-1345 [41460]
   Other proteins in same PDB: d1clia1, d1clib1, d1clic1, d1clid1
   complexed with so4

Details for d1clib2

PDB Entry: 1cli, 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution

PDB Compounds: (B:) protein (phosphoribosyl-aminoimidazole synthetase)

SCOPe Domain Sequences for d1clib2:

Sequence; same for both SEQRES and ATOM records:

>d1clib2 d.139.1.1 (B:1171-1345) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Escherichia coli [TaxId: 562]}
dgskvsdgdvlialgssgphsngyslvrkilevsgcdpqtteldgkpladhllaptriyv
ksvleliekvdvhaiahltgggfweniprvlpdntqavidesswqwpevfnwlqtagnve
hhemyrtfncgvgmiialpapevdkalallnangenawkigiikasdseqrvvie

Timeline for d1clib2:

• d1clib2 first appeared (with stable ids) in SCOP 1.55
  
• d1clib2 appears in SCOPe 2.07