Lineage for d1eiyb6 (1eiy B:191-399)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814768Fold b.153: PheT/TilS domain [56036] (1 superfamily)
    core: 3 layers; contains beta-sandwich of unusual topology
  4. 1814769Superfamily b.153.1: PheT/TilS domain [56037] (2 families) (S)
    contains putative tRNA-binding structural motif
  5. 1814770Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
    Pfam PF03483; decorated with additional structures
  6. 1814771Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 1814772Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1814784Domain d1eiyb6: 1eiy B:191-399 [41458]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5
    protein/RNA complex

Details for d1eiyb6

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1eiyb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb6 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOPe Domain Coordinates for d1eiyb6:

Click to download the PDB-style file with coordinates for d1eiyb6.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb6: