Class b: All beta proteins [48724] (149 folds) |
Fold b.153: PheT/TilS domain [56036] (1 superfamily) core: 3 layers; contains beta-sandwich of unusual topology |
Superfamily b.153.1: PheT/TilS domain [56037] (2 families) contains putative tRNA-binding structural motif |
Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) Pfam 03483; decorated with additional structures |
Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
Species Thermus thermophilus (Thermus aquaticus) [56040] (5 PDB entries) |
Domain d1eiyb6: 1eiy B:191-399 [41458] Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5 |
PDB Entry: 1eiy (more details), 3.3 Å
SCOP Domain Sequences for d1eiyb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiyb6 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)} lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv paqrralsllqalagarvaealleagspk
Timeline for d1eiyb6: