Lineage for d1eiyb6 (1eiy B:191-399)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36055Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily)
  4. 36056Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) (S)
  5. 36057Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
  6. 36058Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 36059Species Thermus thermophilus (Thermus aquaticus) [56040] (4 PDB entries)
  8. Domain d1eiyb6: 1eiy B:191-399 [41458]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5

Details for d1eiyb6

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (B:)

SCOP Domain Sequences for d1eiyb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOP Domain Coordinates for d1eiyb6 are not available.

Timeline for d1eiyb6:

Domains from same chain:
(mouse over for more information)
d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5
Domains from other chains:
(mouse over for more information)
d1eiya1, d1eiya2