SCOP 1.55: Domain d1eiyb6: 1eiy B:191-399

Lineage for d1eiyb6 (1eiy B:191-399)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily)

4. Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family)

5. Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)

6. Protein B3/B4 domain of PheRS, PheT [56039] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [56040] (4 PDB entries)

8. Domain d1eiyb6: 1eiy B:191-399 [41458]
   Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5

Details for d1eiyb6

PDB Entry: 1eiy, 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb6:

Sequence; same for both SEQRES and ATOM records:

>d1eiyb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOP Domain Coordinates for d1eiyb6 are not available.

Timeline for d1eiyb6:

• d1eiyb6 appears in SCOP 1.57
  
• d1eiyb6 appears in the current release, SCOPe 2.08