Lineage for d1b70b6 (1b70 B:191-399)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137800Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily)
  4. 137801Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) (S)
  5. 137802Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
  6. 137803Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 137804Species Thermus thermophilus (Thermus aquaticus) [56040] (5 PDB entries)
  8. 137808Domain d1b70b6: 1b70 B:191-399 [41457]
    Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5

Details for d1b70b6

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70b6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70b6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOP Domain Coordinates for d1b70b6:

Click to download the PDB-style file with coordinates for d1b70b6.
(The format of our PDB-style files is described here.)

Timeline for d1b70b6: