![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.153: PheT/TilS domain [56036] (1 superfamily) core: 3 layers; contains beta-sandwich of unusual topology |
![]() | Superfamily b.153.1: PheT/TilS domain [56037] (2 families) ![]() contains putative tRNA-binding structural motif |
![]() | Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) Pfam PF03483; decorated with additional structures |
![]() | Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d1b7yb6: 1b7y B:191-399 [41456] Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5 protein/RNA complex; complexed with fya, mg |
PDB Entry: 1b7y (more details), 2.5 Å
SCOPe Domain Sequences for d1b7yb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7yb6 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]} lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv paqrralsllqalagarvaealleagspk
Timeline for d1b7yb6: