Lineage for d1b7yb6 (1b7y B:191-399)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813841Fold b.153: PheT/TilS domain [56036] (1 superfamily)
    core: 3 layers; contains beta-sandwich of unusual topology
  4. 813842Superfamily b.153.1: PheT/TilS domain [56037] (2 families) (S)
    contains putative tRNA-binding structural motif
  5. 813843Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
    Pfam PF03483; decorated with additional structures
  6. 813844Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 813845Species Thermus thermophilus [TaxId:274] [56040] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 813851Domain d1b7yb6: 1b7y B:191-399 [41456]
    Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5

Details for d1b7yb6

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate
PDB Compounds: (B:) protein (phenylalanyl-tRNA synthetase)

SCOP Domain Sequences for d1b7yb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb6 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOP Domain Coordinates for d1b7yb6:

Click to download the PDB-style file with coordinates for d1b7yb6.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb6: