Lineage for d1b7yb6 (1b7y B:191-399)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334629Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily)
    3 layers: beta/beta/alpha sandwich
  4. 334630Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) (S)
  5. 334631Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
  6. 334632Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 334633Species Thermus thermophilus (Thermus aquaticus) [56040] (5 PDB entries)
  8. 334636Domain d1b7yb6: 1b7y B:191-399 [41456]
    Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5

Details for d1b7yb6

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOP Domain Coordinates for d1b7yb6:

Click to download the PDB-style file with coordinates for d1b7yb6.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb6: