SCOP 1.57: Domain d1pysb6: 1pys B:191-399

Lineage for d1pysb6 (1pys B:191-399)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily)

4. Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family)

5. Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)

6. Protein B3/B4 domain of PheRS, PheT [56039] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [56040] (4 PDB entries)

8. Domain d1pysb6: 1pys B:191-399 [41455]
   Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb5

Details for d1pysb6

PDB Entry: 1pys, 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb6:

Sequence; same for both SEQRES and ATOM records:

>d1pysb6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

Timeline for d1pysb6:

• d1pysb6 first appeared (with stable ids) in SCOP 1.55
  
• d1pysb6 appears in SCOP 1.59
  
• d1pysb6 appears in the current release, SCOPe 2.08