Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus gii.10 [TaxId:747305] [419941] (9 PDB entries) |
Domain d4z4ya_: 4z4y A: [414537] automated match to d5or7a_ complexed with edo |
PDB Entry: 4z4y (more details), 1.8 Å
SCOPe Domain Sequences for d4z4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z4ya_ b.121.4.0 (A:) automated matches {Norovirus gii.10 [TaxId: 747305]} skpftlpiltlgeltnsrfplpidvlytnpnesaivqcqngrctldgelqgttqllptgi cafrgkvtqqvqdehrgthwnmtvtnlngtpfdptedvpaplgtpdfsgqiygvisqrnt ntvpgegnlpanraheaviatyspkftpklgniqfstwetqdvssgqptkftpvglasvd anshfdqwtlpsysgaltlnmnlapsvapvfpgecllffrsfiplkggygnpaidclmpq ewvqhlyqesapslsdvalvryvnpetgrtlfeaklhrngfltvarnsagpvvaptngyf rfdswvnqfytlapm
Timeline for d4z4ya_: