Lineage for d4ysua2 (4ysu A:167-312)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.0: automated matches [191502] (1 protein)
not a true familyProtein automated matches [190824] (31 species)
not a true protein
Species Geobacillus thermodenitrificans [TaxId:420246] [419887] (18 PDB entries) 
Domain d4ysua2: 4ysu A:167-312 [414520]
automated match to d6thea2
complexed with cu, mpd, so4
Details for d4ysua2
PDB Entry: 4ysu (more details), 1.5 Å
PDB Description: structure of copper nitrite reductase from geobacillus thermodenitrificans - 25.0 mgy
PDB Compounds: (A:) nitrite reductaseSCOPe Domain Sequences for d4ysua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ysua2 b.6.1.0 (A:167-312) automated matches {Geobacillus thermodenitrificans [TaxId: 420246]}
dreyvliqnewykyndmndfqngvpsyvvfsskalkpgdpntngdtftlkekpllakvge
kirlyinnvgpnevssfhvvgtvfddvyldgnpnnhlqgmqtvmlpasggavveftvtrp
gtypivthqfnhaqkgavamlkvtet
SCOPe Domain Coordinates for d4ysua2:
Click to download the PDB-style file with coordinates for d4ysua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ysua2:
- d4ysua2 is new in SCOPe 2.08-stable
View in 3D
