Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Geobacillus thermodenitrificans [TaxId:420246] [419887] (18 PDB entries) |
Domain d4ysua2: 4ysu A:167-312 [414520] automated match to d6thea2 complexed with cu, mpd, so4 |
PDB Entry: 4ysu (more details), 1.5 Å
SCOPe Domain Sequences for d4ysua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ysua2 b.6.1.0 (A:167-312) automated matches {Geobacillus thermodenitrificans [TaxId: 420246]} dreyvliqnewykyndmndfqngvpsyvvfsskalkpgdpntngdtftlkekpllakvge kirlyinnvgpnevssfhvvgtvfddvyldgnpnnhlqgmqtvmlpasggavveftvtrp gtypivthqfnhaqkgavamlkvtet
Timeline for d4ysua2: