Lineage for d1ckva_ (1ckv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978075Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2978076Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2978077Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2978081Protein Soluble methane monooxygenase regulatory protein B [56031] (3 species)
  7. 2978082Species Escherichia coli [TaxId:562] [56032] (1 PDB entry)
  8. 2978083Domain d1ckva_: 1ckv A: [41452]

Details for d1ckva_

PDB Entry: 1ckv (more details)

PDB Description: structure of the soluble methane monooxygenase regulatory protein b
PDB Compounds: (A:) protein (protein b)

SCOPe Domain Sequences for d1ckva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckva_ d.137.1.1 (A:) Soluble methane monooxygenase regulatory protein B {Escherichia coli [TaxId: 562]}
msvnsnaydagimglkgkdfadqffadenqvvhesdtvvlvlkksdeintfieeilltdy
kknvnptvnvedragywwikangkievdcdeisellgrqfnvydflvdvsstigraytlg
nkftitselmgldrkledyha

SCOPe Domain Coordinates for d1ckva_:

Click to download the PDB-style file with coordinates for d1ckva_.
(The format of our PDB-style files is described here.)

Timeline for d1ckva_: