Lineage for d1byra_ (1byr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216700Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2216701Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2216702Family d.136.1.1: Nuclease [56025] (1 protein)
    automatically mapped to Pfam PF13091
  6. 2216703Protein Nuclease Nuc [56026] (1 species)
  7. 2216704Species Salmonella typhimurium [TaxId:90371] [56027] (2 PDB entries)
  8. 2216705Domain d1byra_: 1byr A: [41450]

Details for d1byra_

PDB Entry: 1byr (more details), 2 Å

PDB Description: crystal structure of a phospholipase d family member, nuc from salmonella typhimurium
PDB Compounds: (A:) protein (endonuclease)

SCOPe Domain Sequences for d1byra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byra_ d.136.1.1 (A:) Nuclease Nuc {Salmonella typhimurium [TaxId: 90371]}
epsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivid
ergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkns
enavviwnmpklaesflehwqdrwnqgrdyrs

SCOPe Domain Coordinates for d1byra_:

Click to download the PDB-style file with coordinates for d1byra_.
(The format of our PDB-style files is described here.)

Timeline for d1byra_: