SCOPe 2.05: Domain d1byra_: 1byr A:

Lineage for d1byra_ (1byr A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
   beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234

4. Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families)

5. Family d.136.1.1: Nuclease [56025] (1 protein)
   automatically mapped to Pfam PF13091

6. Protein Nuclease Nuc [56026] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [56027] (2 PDB entries)

8. Domain d1byra_: 1byr A: [41450]

Details for d1byra_

PDB Entry: 1byr, 2 Å

PDB Description: crystal structure of a phospholipase d family member, nuc from salmonella typhimurium

PDB Compounds: (A:) protein (endonuclease)

SCOPe Domain Sequences for d1byra_:

Sequence; same for both SEQRES and ATOM records:

>d1byra_ d.136.1.1 (A:) Nuclease Nuc {Salmonella typhimurium [TaxId: 90371]}
epsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivid
ergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkns
enavviwnmpklaesflehwqdrwnqgrdyrs

Timeline for d1byra_:

• d1byra_ first appeared (with stable ids) in SCOP 1.55
  
• d1byra_ appears in SCOPe 2.04
  
• d1byra_ appears in SCOPe 2.06
  
• d1byra_ appears in the current release, SCOPe 2.08