Lineage for d1duja1 (1duj A:13-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977796Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 2977797Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
    automatically mapped to Pfam PF02301
  5. 2977798Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)
  6. 2977799Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)
  7. 2977800Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries)
  8. 2977809Domain d1duja1: 1duj A:13-197 [41449]
    Other proteins in same PDB: d1duja2
    "apo" form

Details for d1duja1

PDB Entry: 1duj (more details)

PDB Description: solution structure of the spindle assembly checkpoint protein human mad2
PDB Compounds: (A:) spindle assembly checkpoint protein

SCOPe Domain Sequences for d1duja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duja1 d.135.1.1 (A:13-197) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
itlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvve
qlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeirs
virqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsfttti
hkvns

SCOPe Domain Coordinates for d1duja1:

Click to download the PDB-style file with coordinates for d1duja1.
(The format of our PDB-style files is described here.)

Timeline for d1duja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1duja2